PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0308s0280.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 329aa    MW: 37161.1 Da    PI: 7.8324
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0308s0280.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM110.22.4e-3427654128
                     NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +ekewyfF++rd+ky+tg r+nrat+sgyWkatgkdke+++ +++lvg+kktLvfy+grapkgek++Wvmheyrl
  SapurV1A.0308s0280.2.p   2 GEKEWYFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIYRGRTSLVGMKKTLVFYRGRAPKGEKSNWVMHEYRL 76 
                             578**************************************99******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100541.8681101IPR003441NAC domain
SuperFamilySSF1019417.85E-382101IPR003441NAC domain
PfamPF023651.4E-16676IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGEKEWYFFC QRDRKYPTGM RTNRATESGY WKATGKDKEI YRGRTSLVGM KKTLVFYRGR  60
APKGEKSNWV MHEYRLDGKF SYYGLPKASR NEWVVCRIFH KSTGVKKSSI HEIQRMNSFG  120
DDFLDYSSLP PFMDVNQNSR PSTSSFNGGD DNEFKAMAEK SPDGNYFSST SMLNNNQNFV  180
HPANTIYQAP DSSFQYPHQI PASNPLYNFQ TNPNMAGYFH QGKICNSFAN FQNSSFCNND  240
QTLLRSLARN SYGGASGLEK QCKVEQFSSN QSMVSLSQET GLSTDVNTNT EISSVVSKQE  300
IGSHDKVFDD LEGPSAGPIA DLDCLWDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-31110768171NAC domain-containing protein 19
4dul_A2e-31110768171NAC domain-containing protein 19
1ut7_B2e-31110768171NO APICAL MERISTEM PROTEIN
1ut7_A2e-31110768171NO APICAL MERISTEM PROTEIN
1ut4_B2e-31110768171NO APICAL MERISTEM PROTEIN
1ut4_A2e-31110768171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002325402.10.0hypothetical protein POPTR_0019s04710g
TrEMBLB9IPM00.0B9IPM0_POPTR; Uncharacterized protein
STRINGPOPTR_0019s04710.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.13e-73Arabidopsis NAC domain containing protein 87